This is a working overview of Reverse-phase HPLC, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-06-18 and is reviewed periodically as new material appears.
The molecular weight and charge of GHK-Cu depend on the pH and the number of coordinated ligands. At neutral pH, the peptide typically binds one copper ion, but ternary complexes with other biomolecules can form. Spectroscopic methods such as electron paramagnetic resonance and circular dichroism are used to study the coordination environment. Reports on the exact geometry vary because the complex is dynamic in solution. Researchers often use synthetic GHK-Cu rather than extracted material to control stoichiometry and purity.
GHK-Cu is a coordination complex formed from the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide binds copper through its histidine imidazole nitrogen, the terminal amino group, and the deprotonated amide nitrogen. This arrangement creates a square-planar or distorted geometry around the metal center, depending on pH and the presence of competing ligands. The complex occurs naturally in human plasma, saliva, and urine at low concentrations, and its sequence is conserved across many vertebrate species.
Discovery of GHK is generally attributed to work in the 1970s that isolated a plasma factor influencing liver cell behavior. Subsequent studies identified the copper-binding tripeptide and its ability to chelate copper with high affinity. Early reports linked the complex to wound healing and tissue remodeling in animal models. The free peptide and the copper-bound form have different properties, so the two are distinguished in the literature. Whether endogenous GHK-Cu serves a single primary physiological role remains an open question.
Copper content is measured separately, since a peptide assay alone does not report the metal-to-peptide ratio. Elemental techniques such as inductively coupled plasma optical emission spectroscopy quantify copper after acid digestion of the sample. The result is compared with the theoretical value for a one-to-one complex, and a shortfall indicates free peptide or partial dissociation. Suppliers differ in how they state purity, as some quote peptide content and others quote the whole complex. A defined stoichiometry therefore requires both a peptide assay and a copper assay.
Solid GHK-Cu is usually supplied as a lyophilized powder and is kept cold and dry. Moisture, light, and repeated temperature cycling shorten its useful life in the laboratory. In aqueous solution the complex undergoes slow hydrolysis of the peptide backbone and gradual loss of coordinated copper. Buffers containing strong chelators, such as EDTA, compete for the metal and strip it from the peptide. Working solutions are therefore prepared shortly before use, and leftover liquid is not returned to the stock container.
Identity and purity are established with a combination of chromatographic and spectroscopic techniques. Reversed-phase high-performance liquid chromatography separates the intact complex from peptide fragments and free copper, and the elution profile yields a purity estimate. Mass spectrometry gives the mass of the intact species and exposes degradation products. Ultraviolet-visible spectroscopy displays a broad absorption band in the visible region that is characteristic of the copper center. Nuclear magnetic resonance is less informative here, because the paramagnetic metal broadens signals and complicates spectral interpretation.
| Property | Value | Notes |
|---|---|---|
| Peptide sequence | Gly-His-Lys | Tripeptide; copper binds via His and N-terminus |
| Copper stoichiometry | Typically 1 Cu(II) per peptide | Can form ternary complexes under some conditions |
| Molecular formula (peptide) | C14H24N6O4 | Free peptide; copper complex mass differs |
| Appearance (solid) | Blue to blue-green powder | Color derives from copper d-d transitions |
| Solubility | Soluble in water and polar solvents | Solubility depends on pH and counterions |
Stability of GHK-Cu is influenced by light, oxygen, moisture, pH, and temperature. Solid material is generally kept desiccated and frozen to reduce hydrolysis and oxidation, while aqueous solutions are best prepared fresh or stored cold in aliquots. Repeated freeze-thaw cycles can promote aggregation, precipitation, or peptide degradation. Copper coordination may change under strongly acidic or alkaline conditions, potentially altering the complex's spectroscopic properties. Published long-term stability data for specific matrices, such as cosmetic emulsions or biological buffers, are limited, so shelf-life claims should be treated as formulation-specific rather than universal.
Quality control for GHK-Cu relies on documentation and independent testing rather than a single accepted standard. A certificate of analysis may report peptide purity, copper content, residual solvents, water content, and microbial limits, but the underlying methods and acceptance criteria vary by supplier. Verification can include mass confirmation, amino acid analysis, and comparison with a reference standard when one is available. Open questions include how different copper-binding modes or peptide isomers affect measured activity and whether conventional purity assays capture those differences. Buyers of research-grade material typically need to request raw data rather than rely solely on a summary certificate.
Laboratory characterization of GHK-Cu typically combines separation, spectroscopic, and elemental techniques. Reverse-phase high-performance liquid chromatography is widely used to assess peptide purity, often with ultraviolet detection near the copper-related absorption band or with mass spectrometry for identity confirmation. Because the molecule contains copper, elemental methods such as inductively coupled plasma mass spectrometry or atomic absorption spectroscopy are used to quantify metal content and confirm stoichiometry. No single universal pharmacopeial monograph exists for GHK-Cu. Laboratories therefore validate their own methods, and reported purity values depend on the chosen assay and calibration standards.
Identity and purity are assessed mainly by reversed-phase high-performance liquid chromatography with ultraviolet detection, often paired with mass spectrometry to confirm the expected mass. Copper content is measured separately by inductively coupled plasma optical emission spectrometry or atomic absorption spectroscopy, because the peptide assay alone does not establish the metal-to-peptide ratio. Visible spectroscopy provides a rapid check on complex integrity through the absorption band in the visible region. Agreement between the peptide assay and the copper assay is the practical test of whether a sample is the intended complex rather than a mixture.
Aqueous solutions of GHK-Cu are less stable than the dry powder. The peptide backbone is vulnerable to hydrolysis at extreme pH, and copper can be stripped from the complex by strong chelating agents such as EDTA or citrate. Oxidising agents and high concentrations of ascorbic acid can reduce copper(II) and change the complex, which is one reason formulators often keep such ingredients in separate phases. How quickly these changes occur under real storage conditions depends on pH, buffer, temperature and packaging, and quantitative data on the subject are limited.
Stability of GHK-Cu in solution depends on pH, temperature, buffer composition, and oxygen exposure. The copper center can undergo reduction or dissociation, especially in the presence of strong metal chelators such as EDTA. Aqueous solutions are often prepared fresh or stored frozen to limit degradation. Lyophilized solid is more stable than liquid formulations, but it can absorb moisture and should be kept dry. Light exposure may also affect copper complexes, though the effect is often modest.
Purity assessment typically involves high-performance liquid chromatography for the peptide and atomic spectroscopy for copper content. The ratio of copper to peptide is a key quality parameter; a value near one indicates proper stoichiometry. Impurities can include free peptide, copper salts, and truncated sequences from synthesis. Because the complex is dynamic, sample preparation and mobile-phase conditions can shift the observed species. Reported purity values therefore depend on the analytical method and should be interpreted with that context.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and copper(II). The peptide sequence consists of glycine, histidine, and lysine, and its imidazole and amino groups provide binding sites for the metal ion. In the complex, copper is held through nitrogen donors from the histidine side chain, the N-terminal amine, and deprotonated amide nitrogens. The resulting compound is intensely blue and water-soluble. It occurs naturally in human plasma, saliva, and urine at low concentrations.
The peptide was first isolated from human albumin in 1973 by Loren Pickart, who later described its copper-binding behavior. Early work linked the complex to wound healing and tissue remodeling. Plasma levels of GHK decline with age, a pattern that stimulated interest in topical and supplemental applications. Researchers have reported that the tripeptide influences collagen synthesis, antioxidant defense, and inflammatory signaling in cell and animal models. Human clinical evidence remains limited and often relies on small studies.
== End groups in polymer synthesis == End groups are seen on all polymers and the functionality of those end groups can be important in determining the application of polymers. Each type of polymerization (free radical, condensation or etc.) has end groups that are typical for the polymerization, and knowledge of these can help to identify the type of polymerization method used to form the polymer.
== Tetanus Toxoid Immunization Schedule for Women == When given to women of childbearing age, vaccines that contain tetanus toxoid (TT or Td) not only protect women against tetanus, but also prevent neonatal tetanus in their newborn infants.
August 15, 2009: Argentina Even though official government sources state that Argentina's GDP will actually grow this year (and have only recognized a GDP shrinking in June of 0.4% and in July, of 0.3%; both compared to last year's same months), private consulting firms state that Argentine economy has actually been in recession since October 2008. According to them, Argentine GDP shrank 2.9% in the last quarter of 2008, 1.6% in the first quarter of 2009, and 0.6% in the second one. It's widely known in Argentina that the official statistics office in charge of producing this information, INDEC, is not very reliable for trustworthy statistical information, due to the government's mismanagement of the office.
=== Cerebrospinal fluid (lumbar puncture) === Testing of cerebrospinal fluid obtained from a lumbar puncture can provide evidence of chronic inflammation in the central nervous system. Two different biomarkers can show this inflammation with similar accuracy:
The Biochemistry of Metabolism (archived 8 March 2005) Sparknotes SAT biochemistry Overview of biochemistry. School level. MIT Biology Hypertextbook Archived 19 May 2016 at the Portuguese Web Archive Undergraduate-level guide to molecular biology. Human metabolism
Sources: en.wikipedia.org
=== Monoamine oxidase inhibitors === Monoamine oxidase inhibitors (MAOIs) are first-generation antidepressants effective for anxiety treatment but their dietary restrictions, adverse effect profile and availability of newer medications have limited their use. MAOIs include phenelzine, isocarboxazid and tranylcypromine. Pirlindole is a reversible MAOI that lacks dietary restriction.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
===== Acrididae ===== Locust swarming is initiated but not maintained by serotonin, with release being triggered by tactile contact between individuals. This transforms social preference from aversion to a gregarious state that enables coherent groups. Learning in flies and honeybees is affected by the presence of serotonin.
== Biomedical science in the United Kingdom == The healthcare science workforce is an important part of the UK's National Health Service. While people working in healthcare science are only 5% of the staff of the NHS, 80% of all diagnoses can be attributed to their work. The volume of specialist healthcare science work is a significant part of the work of the NHS. Every year, NHS healthcare scientists carry out:
Sources: en.wikipedia.org
GHK-Cu is a complex of the tripeptide glycyl-L-histidyl-L-lysine with copper(II). The peptide coordinates the metal through its histidine imidazole, terminal amino group, and amide nitrogen. It is studied in biochemistry and dermatological research.
Yes, the peptide and its copper complex have been detected in human plasma, saliva, and urine. Endogenous concentrations are low and vary with physiological state. Its natural functions are not fully established.
Copper binding changes the peptide's charge, shape, and reactivity. The complex can participate in redox chemistry and interact with proteins differently than the free peptide. These differences are why studies specify whether they used GHK or GHK-Cu.
Lyophilized material is normally held at about minus twenty degrees Celsius in a sealed, desiccated vial. Dissolved samples are less durable and are prepared fresh. Repeated freeze-thaw cycles are avoided.