Everything below concerns stoichiometry. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-01-16. Numbers and descriptions here follow the published literature rather than marketing material.
Analytical verification commonly relies on high-performance liquid chromatography for purity assessment and mass spectrometry for identity confirmation. Spectroscopic methods such as UV-visible absorption and electron paramagnetic resonance can probe the metal centre itself, since the d9 configuration of copper(II) produces characteristic signals. Elemental analysis or plasma-based techniques quantify copper content. Because each method reports a different aspect of the same sample, purity figures are most meaningful when the technique and its detection wavelength are stated alongside the value.
Stability of the complex in solution depends on pH, temperature, and the presence of competing ligands. It is generally described as more resistant to breakdown than the metal-free chain, since coordination reduces susceptibility to enzymatic attack. Oxidation and hydrolysis can nevertheless proceed over time in aqueous media. Storage guidance in laboratory settings commonly involves refrigeration, protection from light, and avoidance of strongly alkaline conditions. Published data on long-term behaviour vary considerably and depend on the specific matrix.
Published work on GHK-Cu is dominated by in vitro experiments and small animal studies. Human trials tend to be short and small, with endpoints such as skin appearance rather than clinical outcomes. Review articles often summarize the same underlying laboratory findings, which can make the evidence base look broader than it is. Several basic questions remain open: the concentration of the intact complex in human tissue, the route by which it crosses the skin barrier, and whether effects seen in culture produce measurable changes in people.
Laboratory studies describe GHK-Cu as a source of copper that cells can take up, with reported effects on collagen, elastin, and glycosaminoglycan synthesis in cultured fibroblasts. The peptide also appears in wound-repair research, where it is linked to the activity of matrix metalloproteinases and their inhibitors. These observations come largely from cell and animal models. How directly the complex controls any single pathway in intact human skin remains an open question, and reported effects depend on concentration, vehicle, and exposure time.
| Property | Value | Notes |
|---|---|---|
| Appearance | Blue crystalline solid | Colour arises from copper(II) d-d transitions |
| Water solubility | Readily soluble | Extent varies with pH and counterion |
| Typical storage | Minus 20 degrees Celsius, desiccated | Protect from light and moisture |
| Purity method | Reverse-phase HPLC, UV detection | Wavelength typically 214 or 220 nanometres |
| Identity method | Mass spectrometry | Confirms peptide mass and copper content |
The peptide was first isolated from human albumin in 1973 by Loren Pickart, who later described its copper-binding behavior. Early work linked the complex to wound healing and tissue remodeling. Plasma levels of GHK decline with age, a pattern that stimulated interest in topical and supplemental applications. Researchers have reported that the tripeptide influences collagen synthesis, antioxidant defense, and inflammatory signaling in cell and animal models. Human clinical evidence remains limited and often relies on small studies.
Commercial products list GHK-Cu as copper tripeptide-1, a cosmetic ingredient. Formulators value its blue color and water solubility, which allow incorporation into serums, creams, and masks. Regulatory treatment varies: in the United States it appears in cosmetics, while some jurisdictions classify certain claims as drug-like. The compound is not an approved drug for any indication. Studies continue to examine its effects on skin, hair, and wound repair, but dosage, delivery, and long-term safety questions remain open.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and copper(II). The peptide sequence consists of glycine, histidine, and lysine, and its imidazole and amino groups provide binding sites for the metal ion. In the complex, copper is held through nitrogen donors from the histidine side chain, the N-terminal amine, and deprotonated amide nitrogens. The resulting compound is intensely blue and water-soluble. It occurs naturally in human plasma, saliva, and urine at low concentrations.
Laboratory characterization of GHK-Cu typically combines separation, spectroscopic, and elemental techniques. Reverse-phase high-performance liquid chromatography is widely used to assess peptide purity, often with ultraviolet detection near the copper-related absorption band or with mass spectrometry for identity confirmation. Because the molecule contains copper, elemental methods such as inductively coupled plasma mass spectrometry or atomic absorption spectroscopy are used to quantify metal content and confirm stoichiometry. No single universal pharmacopeial monograph exists for GHK-Cu. Laboratories therefore validate their own methods, and reported purity values depend on the chosen assay and calibration standards.
Stability of GHK-Cu is influenced by light, oxygen, moisture, pH, and temperature. Solid material is generally kept desiccated and frozen to reduce hydrolysis and oxidation, while aqueous solutions are best prepared fresh or stored cold in aliquots. Repeated freeze-thaw cycles can promote aggregation, precipitation, or peptide degradation. Copper coordination may change under strongly acidic or alkaline conditions, potentially altering the complex's spectroscopic properties. Published long-term stability data for specific matrices, such as cosmetic emulsions or biological buffers, are limited, so shelf-life claims should be treated as formulation-specific rather than universal.
The peptide portion consists of three amino acids: glycine, histidine and lysine. Copper(II) coordinates through the imidazole nitrogen of histidine, the alpha-amino group of glycine and a deprotonated amide nitrogen of the backbone, producing a roughly square-planar geometry. This arrangement gives the complex its characteristic blue-to-violet colour and helps it resist dissociation in water. Reported stability constants are high, although values differ between studies because of differences in ionic strength and measurement method.
The International Nomenclature of Cosmetic Ingredients lists the substance as copper tripeptide-1, the name that appears on most topical product labels. Related designations include copper peptide and GHK-Cu, and the hyphenated form is common in research literature. In cosmetics the material is regulated as an ingredient rather than as a drug, so products may reach the market without evidence of the effects claimed for them. Whether those effects are clinically meaningful is an open question, since most supportive data come from laboratory work and small trials.
GHK-Cu is the copper complex of the tripeptide glycyl-L-histidyl-L-lysine, a short sequence found naturally in human plasma, saliva and urine. Loren Pickart reported the isolation of the free peptide in 1973 while studying factors that influenced the growth of aged liver cells in culture. The peptide was later shown to bind copper(II) with high affinity, and the metal-bound form became the focus of most subsequent research. Its concentration in circulation declines markedly with age, a pattern that is well documented, though the physiological consequences of that decline remain debated.
Quality specifications for research material commonly state peptide purity, copper stoichiometry, counter-ion identity, and residual water content. Frequent counter-ions include acetate and trifluoroacetate, which differ in mass and in their effect on solubility and handling. Whether batch-to-batch differences in reported responses trace to these parameters or to assay conditions remains an open question, since published comparisons rarely control for all of them at once. Independent verification therefore normally pairs a purity measurement with an elemental copper measurement on the same lot.
Practical handling notes centre on limiting exposure to water, oxygen, and repeated temperature cycling. Weighed powder is often equilibrated to room temperature before opening to avoid condensation on the solid. Working solutions are typically divided into single-use aliquots and frozen rather than stored refrigerated for long periods. Reported shelf lives vary widely between laboratories, and no single set of conditions is universally treated as a reference standard, which complicates direct comparison of published stability figures.
Solutions of GHK-Cu respond strongly to pH, redox conditions, and the presence of competing chelators such as EDTA. Below roughly pH 4 the copper tends to dissociate, because the amide nitrogen donors become protonated and can no longer coordinate. Strongly alkaline conditions instead favour hydrolysis and precipitation of copper hydroxide. Dissolved oxygen and light accelerate breakdown of the peptide backbone, and the copper released during that process can catalyse further oxidation, so dry, cold, dark storage is the usual recommendation.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES. In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Furthermore, Oxgr1 gene knockout mice drinking sodium bicarbonate-rich water developed metabolic alkalosis (body tissue pH levels higher than normal) that was associated with blood bicarbonate levels significantly higher and blood chloride levels significantly lower than those in control mice drinking the sodium bicarbonate-rich water. Several other studies confirmed these findings and reported that cells in the proximal tubules of mice synthesize α-ketoglutarate and either broke it down thereby reducing its urine levels or secreted it into the tubules' lumens thereby increasing its urine levels. Another study showed that a) In silico computer simulations strongly suggested that α-ketoglutarate bound to mouse OXGPR1; b) suspensions of canal duct cells isolated from the collecting ducts, loops of Henle, vasa recta, and interstitium of mouse kidneys raised their cytosolic ionic calcium, i.e., Ca2+ levels in response to α-ketoglutarate but this response (which is an indicator of cell activation) was blocked by pretreating the cells with montelukast; and c) compared to mice not treated with streptozotocin, streptozotocin-induced diabetic mice (an animal disease model of diabetes) urinated only a small amount of the ionic sodium (Na+) that they drank or received by intravenous injections; montelukast reversed this defect in the streptozotocin-pretreated mice.
The courts give the EU a wide discretion to implement policy, so judicial review is possible only if agricultural measures are 'manifestly inappropriate'. EU law does not yet have a systematic plan or subsidies to rewild depleted environments, and to move to complete clean energy infrastructure.
In addition, state projects such as the Cinturão das Águas do Ceará, the Eixão das Águas (Ceará), the Seridó Norte water pipeline, the Agreste Potiguar water pipeline, the Vertentes Litorâneas da Paraíba, the Agreste Pernambucano water pipeline and the Canal do Sertão Alagoano have received federal funding for their development.
=== Analgesia and abuse liability === Recent studies indicate that targeting NOP is a promising alternative route to relieving pain without the deleterious side effects of traditional MOP-activating opioid therapies. In primates, specifically activating NOP through systemic or intrathecal administration induces long-lasting, morphine-comparable analgesia without causing itch, respiratory depression, or the reinforcing effects that lead to addiction in an intravenous self-administration paradigm; thus eliminating all of the serious side-effects of current opioid therapies. Several commonly used opioid drugs including etorphine and buprenorphine have been demonstrated to bind to nociceptin receptors, but this binding is relatively insignificant compared to their activity at other opioid receptors in the acute setting (however the non-analgesic NOPr antagonist SB-612,111 was demonstrated to potentiate the therapeutic benefits of morphine). Chronic administration of nociceptin receptor agonists results in an attenuation of the analgesic and anti-allodynic effects of opiates; this mechanism inhibits the action of endogenous opioids as well, resulting in an increase in pain severity, depression, and both physical and psychological opiate dependence following chronic NOPr agonist administration. Administration of the NOPr antagonist SB-612,111 has been shown to inhibit this process. More recently a range of selective ligands for NOP have been developed, which show little or no affinity to other opioid receptors and so allow NOP-mediated responses to be studied in isolation.
Sources: en.wikipedia.org
Chinese dessert soups are typically sweet and served hot. European pastries are also seen in China, like mille-feuille, crème brûlée, and cheesecake, but they are generally not as popular because the Chinese preference of dessert is mildly sweet and less oily.
== Economy == The territories of the Russian Partition saw very moderate economic growth over time. No business activity could take place without bribing the Tsarist officials first. Much of the output of the Polish Partition was exported to Russia proper, especially after the border between Congress Poland and Russia was abolished in 1851. The emancipation reform of 1861 was a major step towards industrialization and urbanization. Particularly, the last three or four decades before World War I saw significant economic development and urbanization. However, in many areas of the economy, development stalled.
A major hurdle to overcome is the long reaction time for complete rotation in these systems, which does not compare to rotation speeds displayed by motor proteins in biological systems. In the fastest system to date, with a fluorene lower half, the half-life of the thermal helix inversion is 0.005 seconds. This compound is synthesized using the Barton-Kellogg reaction. In this molecule the slowest step in its rotation, the thermally induced helix-inversion, is believed to proceed much more quickly because the larger tert-butyl group makes the unstable isomer even less stable than when the methyl group is used. This is because the unstable isomer is more destabilized than the transition state that leads to helix-inversion. The different behaviour of the two molecules is illustrated by the fact that the half-life time for the compound with a methyl group instead of a tert-butyl group is 3.2 minutes. The Feringa principle has been incorporated into a prototype nanocar. The car synthesized has a helicene-derived engine with an oligo (phenylene ethynylene) chassis and four carborane wheels and is expected to be able to move on a solid surface with scanning tunneling microscopy monitoring, although so far this has not been observed. The motor does not perform with fullerene wheels because they quench the photochemistry of the motor moiety. Feringa motors have also been shown to remain operable when chemically attached to solid surfaces. The ability of certain Feringa systems to act as an asymmetric catalyst has also been demonstrated.
=== Extended market indices === Russell 3000 Index: The Russell 3000 Index measures the performance of the largest 3,000 U.S. companies representing approximately 98% of the investable U.S. equity market.
Sources: en.wikipedia.org
Reverse-phase high-performance liquid chromatography with ultraviolet detection is the most common approach. Purity is expressed as a share of total peak area at a specified wavelength. Mass spectrometry is then used to confirm molecular identity.
Solid material is often held at refrigerator or freezer temperatures, typically between minus 20 and 4 degrees Celsius. Desiccation limits moisture uptake. Solution stability is generally shorter and varies with pH and buffer composition.
Electron paramagnetic resonance is suited to copper(II) because of its unpaired electron. UV-visible spectroscopy reveals ligand-to-metal charge transfer bands. Both methods report on coordination rather than on peptide purity.
It is not approved as a pharmaceutical in major markets and is used mainly as a cosmetic ingredient and a laboratory reagent. Regulatory status varies by country and by the product category in which it appears. Claims about therapeutic effects should be treated separately from permitted cosmetic labeling.